Lineage for d1j9ga_ (1j9g A:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.23: Flavodoxin-like [52171] (17 superfamilies) 
Superfamily c.23.5: Flavoproteins [52218] (3 families) 
Family c.23.5.1: Flavodoxin-related [52219] (3 proteins) Protein Flavodoxin [52220] (6 species) Species Desulfovibrio vulgaris [TaxId:881] [52222] (20 PDB entries) 
Domain d1j9ga_: 1j9g A: [62757]
Details for d1j9ga_
PDB Entry: 1j9g (more details), 2.4 Å
PDB Description: low temperature (100k) crystal structure of flavodoxin d. vulgaris s64c mutant, monomer oxidised, at 2.4 angstrom resolution
SCOP Domain Sequences for d1j9ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j9ga_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris}
akalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
ddcielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai
SCOP Domain Coordinates for d1j9ga_:
Click to download the PDB-style file with coordinates for d1j9ga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j9ga_:
- d1j9ga_ is new in SCOP 1.57
- d1j9ga_ appears in SCOP 1.59
- d1j9ga_ appears in the current release, SCOPe 2.08
View in 3D