Lineage for d1j98a_ (1j98 A:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) 
Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (1 protein) Protein Autoinducer-2 production protein LuxS [64295] (4 species) Species Bacillus subtilis [TaxId:1423] [64296] (1 PDB entry) 
Domain d1j98a_: 1j98 A: [62755]
Details for d1j98a_
PDB Entry: 1j98 (more details), 1.2 Å
PDB Description: the 1.2 angstrom structure of bacillus subtilis luxs
SCOP Domain Sequences for d1j98a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j98a_ d.185.1.2 (A:) Autoinducer-2 production protein LuxS {Bacillus subtilis}
vesfeldhnavvapyvrhcgvhkvgtdgvvnkfdirfcqpnkqamkpdtihtlehllaft
irshaekydhfdiidispmgcqtgyylvvsgettsaeivdlledtmkeaveiteipaane
kqcgqaklhdlegakrlmrfwlsqdkeellkvfg
SCOP Domain Coordinates for d1j98a_:
Click to download the PDB-style file with coordinates for d1j98a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j98a_:
- d1j98a_ is new in SCOP 1.57
- d1j98a_ appears in SCOP 1.59
- d1j98a_ appears in the current release, SCOPe 2.08
View in 3D