Lineage for d1j97b_ (1j97 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148571Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2148572Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2148733Family c.108.1.4: Phosphoserine phosphatase [64511] (1 protein)
    the insertion subdomain is a 4-helical bundle
    automatically mapped to Pfam PF06888
    automatically mapped to Pfam PF12710
  6. 2148734Protein Phosphoserine phosphatase [64512] (2 species)
  7. 2148742Species Methanococcus jannaschii [TaxId:2190] [64513] (6 PDB entries)
  8. 2148744Domain d1j97b_: 1j97 B: [62754]
    Phospho-aspartyl intermediate analogue
    complexed with mg, po4

Details for d1j97b_

PDB Entry: 1j97 (more details), 1.5 Å

PDB Description: Phospho-Aspartyl Intermediate Analogue of Phosphoserine phosphatase
PDB Compounds: (B:) Phosphoserine Phosphatase

SCOPe Domain Sequences for d1j97b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j97b_ c.108.1.4 (B:) Phosphoserine phosphatase {Methanococcus jannaschii [TaxId: 2190]}
kkkklilfdfdstlvnnetideiareagveeevkkitkeamegklnfeqslrkrvsllkd
lpiekvekaikritptegaeetikelknrgyvvavvsggfdiavnkikeklgldyafanr
livkdgkltgdvegevlkenakgeilekiakieginledtvavgdgandismfkkaglki
afcakpilkekadiciekrdlreilkyik

SCOPe Domain Coordinates for d1j97b_:

Click to download the PDB-style file with coordinates for d1j97b_.
(The format of our PDB-style files is described here.)

Timeline for d1j97b_: