SCOPe 2.05: Domain d1j97a_: 1j97 A:

Lineage for d1j97a_ (1j97 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.4: Phosphoserine phosphatase [64511] (1 protein)
   the insertion subdomain is a 4-helical bundle
   automatically mapped to Pfam PF06888
   automatically mapped to Pfam PF12710

6. Protein Phosphoserine phosphatase [64512] (2 species)

7. Species Methanococcus jannaschii [TaxId:2190] [64513] (6 PDB entries)

8. Domain d1j97a_: 1j97 A: [62753]
   Phospho-aspartyl intermediate analogue
   complexed with mg, po4

Details for d1j97a_

PDB Entry: 1j97, 1.5 Å

PDB Description: Phospho-Aspartyl Intermediate Analogue of Phosphoserine phosphatase

PDB Compounds: (A:) Phosphoserine Phosphatase

SCOPe Domain Sequences for d1j97a_:

Sequence; same for both SEQRES and ATOM records:

>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Methanococcus jannaschii [TaxId: 2190]}
ekkkklilfdfdstlvnnetideiareagveeevkkitkeamegklnfeqslrkrvsllk
dlpiekvekaikritptegaeetikelknrgyvvavvsggfdiavnkikeklgldyafan
rlivkdgkltgdvegevlkenakgeilekiakieginledtvavgdgandismfkkaglk
iafcakpilkekadiciekrdlreilkyik

Timeline for d1j97a_:

• d1j97a_ first appeared in SCOP 1.57
  
• d1j97a_ appears in SCOPe 2.04
  
• d1j97a_ appears in SCOPe 2.06
  
• d1j97a_ appears in the current release, SCOPe 2.08