SCOP 1.73: Domain d1j95d_: 1j95 D:

Lineage for d1j95d_ (1j95 D:)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins)

6. Protein Potassium channel protein [56901] (1 species)

7. Species Streptomyces coelicolor [TaxId:1902] [56902] (27 PDB entries)
   identical sequence to Streptomyces lividans, TaxId: 1916

8. Domain d1j95d_: 1j95 D: [62752]
   residues 24-121
   complexed with k, tba; mutant

Details for d1j95d_

PDB Entry: 1j95, 2.8 Å

PDB Description: kcsa potassium channel with tba (tetrabutylammonium) and potassium

PDB Compounds: (D:) Voltage-gated potassium channel

SCOP Domain Sequences for d1j95d_:

Sequence; same for both SEQRES and ATOM records:

>d1j95d_ f.14.1.1 (D:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
lhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlyp
vtlwgrcvavvvmvagitsfglvtaalatwfvgreqer

Timeline for d1j95d_:

• d1j95d_ first appeared in SCOP 1.57
  
• d1j95d_ appears in SCOP 1.71
  
• d1j95d_ appears in SCOP 1.75
  
• d1j95d_ appears in the current release, SCOPe 2.08