Lineage for d1j95c_ (1j95 C:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237462Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 1237463Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) (S)
  5. 1237464Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 1237481Protein Potassium channel protein [56901] (2 species)
  7. 1237482Species Streptomyces coelicolor [TaxId:1902] [56902] (18 PDB entries)
    identical sequence to Streptomyces lividans, TaxId: 1916
    Uniprot Q54397 22-124
  8. 1237503Domain d1j95c_: 1j95 C: [62751]
    residues 24-121
    complexed with k, tba

Details for d1j95c_

PDB Entry: 1j95 (more details), 2.8 Å

PDB Description: kcsa potassium channel with tba (tetrabutylammonium) and potassium
PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d1j95c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j95c_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
lhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlyp
vtlwgrcvavvvmvagitsfglvtaalatwfvgreqer

SCOPe Domain Coordinates for d1j95c_:

Click to download the PDB-style file with coordinates for d1j95c_.
(The format of our PDB-style files is described here.)

Timeline for d1j95c_: