SCOP 1.57: Domain d1j95b_: 1j95 B:

Lineage for d1j95b_ (1j95 B:)

1. Root: SCOP 1.57

2. Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (10 families)

5. Family f.2.1.11: Oligomeric gated channels [63383] (3 proteins)

6. Protein Potassium chanel protein [56901] (1 species)

7. Species Streptomyces lividans [TaxId:1916] [56902] (3 PDB entries)

8. Domain d1j95b_: 1j95 B: [62750]

Details for d1j95b_

PDB Entry: 1j95, 2.8 Å

PDB Description: kcsa potassium channel with tba (tetrabutylammonium) and potassium

SCOP Domain Sequences for d1j95b_:

Sequence; same for both SEQRES and ATOM records:

>d1j95b_ f.2.1.11 (B:) Potassium chanel protein {Streptomyces lividans}
lhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlyp
vtlwgrcvavvvmvagitsfglvtaalatwfvgreqer

Timeline for d1j95b_:

• d1j95b_ is new in SCOP 1.57
  
• d1j95b_ appears in SCOP 1.59
  
• d1j95b_ appears in the current release, SCOPe 2.08