SCOP 1.65: Domain d1j95a_: 1j95 A:

Lineage for d1j95a_ (1j95 A:)

1. Root: SCOP 1.65

2. Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (4 proteins)

6. Protein Potassium channel protein [56901] (1 species)

7. Species Streptomyces lividans [TaxId:1916] [56902] (8 PDB entries)

8. Domain d1j95a_: 1j95 A: [62749]

Details for d1j95a_

PDB Entry: 1j95, 2.8 Å

PDB Description: kcsa potassium channel with tba (tetrabutylammonium) and potassium

SCOP Domain Sequences for d1j95a_:

Sequence; same for both SEQRES and ATOM records:

>d1j95a_ f.14.1.1 (A:) Potassium channel protein {Streptomyces lividans}
lhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlyp
vtlwgrcvavvvmvagitsfglvtaalatwfvgreqer

Timeline for d1j95a_:

• d1j95a_ first appeared in SCOP 1.57
  
• d1j95a_ appears in SCOP 1.63
  
• d1j95a_ appears in SCOP 1.67
  
• d1j95a_ appears in the current release, SCOPe 2.08