Lineage for d1j8yf2 (1j8y F:87-292)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111791Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 protein domains)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2111930Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)
  7. 2111931Species Acidianus ambivalens [TaxId:2283] [64023] (2 PDB entries)
  8. 2111932Domain d1j8yf2: 1j8y F:87-292 [62748]
    Other proteins in same PDB: d1j8yf1, d1j8yf3
    mutant

Details for d1j8yf2

PDB Entry: 1j8y (more details), 2 Å

PDB Description: Signal Recognition Particle conserved GTPase domain from A. ambivalens T112A mutant
PDB Compounds: (F:) signal recognition 54 kda protein

SCOPe Domain Sequences for d1j8yf2:

Sequence, based on SEQRES records: (download)

>d1j8yf2 c.37.1.10 (F:87-292) GTPase domain of the signal sequence recognition protein Ffh {Acidianus ambivalens [TaxId: 2283]}
dkepkvipdkipyvimlvgvqgtgkattagklayfykkkgfkvglvgadvyrpaaleqlq
qlgqqigvpvygepgekdvvgiakrgvekflsekmeiiivdtagrhgygeeaalleemkn
iyeaikpdevtlvidasigqkaydlaskfnqaskigtiiitkmdgtakgggalsavaatg
atikfigtgekidelevfnprrfvar

Sequence, based on observed residues (ATOM records): (download)

>d1j8yf2 c.37.1.10 (F:87-292) GTPase domain of the signal sequence recognition protein Ffh {Acidianus ambivalens [TaxId: 2283]}
dkepkvipdkipyvimlvgvqgttagklayfykkkgfkvglvgadvyrpaaleqlqqlgq
qigvpvygepgekdvvgiakrgvekflsekmeiiivdtagrhgygeeaalleemkniyea
ikpdevtlvidasigqkaydlaskfnqaskigtiiitkmdgtakgggalsavaatgatik
figtgekidelevfnprrfvar

SCOPe Domain Coordinates for d1j8yf2:

Click to download the PDB-style file with coordinates for d1j8yf2.
(The format of our PDB-style files is described here.)

Timeline for d1j8yf2: