SCOP 1.57: Domain d1j8yf1: 1j8y F:3-86

Lineage for d1j8yf1 (1j8y F:3-86)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.29: Bromodomain-like [47363] (2 superfamilies)

4. Superfamily a.29.1: Domain of the SRP/SRP receptor G-proteins [47364] (1 family)

5. Family a.29.1.1: Domain of the SRP/SRP receptor G-proteins [47365] (2 proteins)

6. Protein Signal sequence recognition protein Ffh [47366] (2 species)

7. Species Archaeon Acidianus ambivalens [TaxId:2283] [63538] (2 PDB entries)

8. Domain d1j8yf1: 1j8y F:3-86 [62747]
   Other proteins in same PDB: d1j8yf2

Details for d1j8yf1

PDB Entry: 1j8y, 2 Å

PDB Description: signal recognition particle conserved gtpase domain from a. ambivalens t112a mutant

SCOP Domain Sequences for d1j8yf1:

Sequence; same for both SEQRES and ATOM records:

>d1j8yf1 a.29.1.1 (F:3-86) Signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens}
lldnlrdtvrkfltgsssydkavedfikelqkslisadvnvklvfsltnkikerlknekp
ptyierrewfikivydelsnlfgg

Timeline for d1j8yf1:

• d1j8yf1 is new in SCOP 1.57
  
• d1j8yf1 appears in SCOP 1.59
  
• d1j8yf1 appears in the current release, SCOPe 2.08