SCOP 1.73: Domain d1j8sa_: 1j8s A:

Lineage for d1j8sa_ (1j8s A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (6 families)

5. Family b.2.3.3: PapG adhesin receptor-binding domain [63680] (1 protein)

6. Protein PapG adhesin receptor-binding domain [63681] (1 species)

7. Species Escherichia coli [TaxId:562] [63682] (2 PDB entries)

8. Domain d1j8sa_: 1j8s A: [62746]

Details for d1j8sa_

PDB Entry: 1j8s, 2.1 Å

PDB Description: papg adhesin receptor binding domain-unbound form

PDB Compounds: (A:) pyelonephritic adhesin

SCOP Domain Sequences for d1j8sa_:

Sequence; same for both SEQRES and ATOM records:

>d1j8sa_ b.2.3.3 (A:) PapG adhesin receptor-binding domain {Escherichia coli [TaxId: 562]}
wnnivfyslgdvnsyqggnvvitqrpqfitswrpgiatvtwnqcngpefadgfwayyrey
iawvvfpkkvmtqngyplfievhnkgswseentgdndsyfflkgykwderafdagnlcqk
pgeitrltekfddiifkvalpadlplgdysvkipytsgmqrhfasylgarfkipynvakt
lprenemlflfknigg

Timeline for d1j8sa_:

• d1j8sa_ first appeared in SCOP 1.57
  
• d1j8sa_ appears in SCOP 1.71
  
• d1j8sa_ appears in SCOP 1.75
  
• d1j8sa_ appears in the current release, SCOPe 2.08