Lineage for d1j8sa_ (1j8s A:)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies) 
Superfamily b.2.3: Bacterial adhesins [49401] (3 families) 
Family b.2.3.3: PapG adhesin receptor-binding domain [63680] (1 protein) Protein PapG adhesin receptor-binding domain [63681] (1 species) Species Escherichia coli [TaxId:562] [63682] (2 PDB entries) 
Domain d1j8sa_: 1j8s A: [62746]
Details for d1j8sa_
PDB Entry: 1j8s (more details), 2.1 Å
PDB Description: papg adhesin receptor binding domain-unbound form
SCOP Domain Sequences for d1j8sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j8sa_ b.2.3.3 (A:) PapG adhesin receptor-binding domain {Escherichia coli}
wnnivfyslgdvnsyqggnvvitqrpqfitswrpgiatvtwnqcngpefadgfwayyrey
iawvvfpkkvmtqngyplfievhnkgswseentgdndsyfflkgykwderafdagnlcqk
pgeitrltekfddiifkvalpadlplgdysvkipytsgmqrhfasylgarfkipynvakt
lprenemlflfknigg
SCOP Domain Coordinates for d1j8sa_:
Click to download the PDB-style file with coordinates for d1j8sa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j8sa_:
- d1j8sa_ is new in SCOP 1.57
- d1j8sa_ appears in SCOP 1.59
- d1j8sa_ appears in the current release, SCOPe 2.08
View in 3D