Class b: All beta proteins [48724] (176 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.3: PapG adhesin receptor-binding domain [63680] (1 protein) automatically mapped to Pfam PF03627 |
Protein PapG adhesin receptor-binding domain [63681] (1 species) |
Species Escherichia coli [TaxId:562] [63682] (2 PDB entries) |
Domain d1j8ra_: 1j8r A: [62745] |
PDB Entry: 1j8r (more details), 1.8 Å
SCOPe Domain Sequences for d1j8ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j8ra_ b.2.3.3 (A:) PapG adhesin receptor-binding domain {Escherichia coli [TaxId: 562]} wnnivfyslgdvnsyqggnvvitqrpqfitswrpgiatvtwnqcngpefadgfwayyrey iawvvfpkkvmtqngyplfievhnkgswseentgdndsyfflkgykwderafdagnlcqk pgeitrltekfddiifkvalpadlplgdysvkipytsgmqrhfasylgarfkipynvakt lprenemlflfknigg
Timeline for d1j8ra_: