Lineage for d1j8ra_ (1j8r A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 105991Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 106050Superfamily b.2.3: Bacterial adhesins [49401] (3 families) (S)
  5. 106077Family b.2.3.3: PapG adhesin receptor-binding domain [63680] (1 protein)
  6. 106078Protein PapG adhesin receptor-binding domain [63681] (1 species)
  7. 106079Species Escherichia coli [TaxId:562] [63682] (2 PDB entries)
  8. 106080Domain d1j8ra_: 1j8r A: [62745]

Details for d1j8ra_

PDB Entry: 1j8r (more details), 1.8 Å

PDB Description: binary complex of the papg receptor-binding domain bound to gbo4 receptor

SCOP Domain Sequences for d1j8ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j8ra_ b.2.3.3 (A:) PapG adhesin receptor-binding domain {Escherichia coli}
wnnivfyslgdvnsyqggnvvitqrpqfitswrpgiatvtwnqcngpefadgfwayyrey
iawvvfpkkvmtqngyplfievhnkgswseentgdndsyfflkgykwderafdagnlcqk
pgeitrltekfddiifkvalpadlplgdysvkipytsgmqrhfasylgarfkipynvakt
lprenemlflfknigg

SCOP Domain Coordinates for d1j8ra_:

Click to download the PDB-style file with coordinates for d1j8ra_.
(The format of our PDB-style files is described here.)

Timeline for d1j8ra_: