Lineage for d1j8ra_ (1j8r A:)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies) 
Superfamily b.2.3: Bacterial adhesins [49401] (3 families) 
Family b.2.3.3: PapG adhesin receptor-binding domain [63680] (1 protein) Protein PapG adhesin receptor-binding domain [63681] (1 species) Species Escherichia coli [TaxId:562] [63682] (2 PDB entries) 
Domain d1j8ra_: 1j8r A: [62745]
Details for d1j8ra_
PDB Entry: 1j8r (more details), 1.8 Å
PDB Description: binary complex of the papg receptor-binding domain bound to gbo4 receptor
SCOP Domain Sequences for d1j8ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j8ra_ b.2.3.3 (A:) PapG adhesin receptor-binding domain {Escherichia coli}
wnnivfyslgdvnsyqggnvvitqrpqfitswrpgiatvtwnqcngpefadgfwayyrey
iawvvfpkkvmtqngyplfievhnkgswseentgdndsyfflkgykwderafdagnlcqk
pgeitrltekfddiifkvalpadlplgdysvkipytsgmqrhfasylgarfkipynvakt
lprenemlflfknigg
SCOP Domain Coordinates for d1j8ra_:
Click to download the PDB-style file with coordinates for d1j8ra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j8ra_:
- d1j8ra_ is new in SCOP 1.57
- d1j8ra_ appears in SCOP 1.59
- d1j8ra_ appears in the current release, SCOPe 2.08
View in 3D