SCOPe 2.08: Domain d1j8ra_: 1j8r A:

Lineage for d1j8ra_ (1j8r A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.3: PapG adhesin receptor-binding domain [63680] (2 proteins)
   automatically mapped to Pfam PF03627

6. Protein PapG adhesin receptor-binding domain [63681] (1 species)

7. Species Escherichia coli [TaxId:562] [63682] (2 PDB entries)

8. Domain d1j8ra_: 1j8r A: [62745]

Details for d1j8ra_

PDB Entry: 1j8r, 1.8 Å

PDB Description: binary complex of the papg receptor-binding domain bound to gbo4 receptor

PDB Compounds: (A:) pyelonephritic adhesin

SCOPe Domain Sequences for d1j8ra_:

Sequence; same for both SEQRES and ATOM records:

>d1j8ra_ b.2.3.3 (A:) PapG adhesin receptor-binding domain {Escherichia coli [TaxId: 562]}
wnnivfyslgdvnsyqggnvvitqrpqfitswrpgiatvtwnqcngpefadgfwayyrey
iawvvfpkkvmtqngyplfievhnkgswseentgdndsyfflkgykwderafdagnlcqk
pgeitrltekfddiifkvalpadlplgdysvkipytsgmqrhfasylgarfkipynvakt
lprenemlflfknigg

Timeline for d1j8ra_:

• d1j8ra_ first appeared in SCOP 1.57
  
• d1j8ra_ appears in SCOPe 2.07