SCOPe 2.03: Domain d1j8qa_: 1j8q A:

Lineage for d1j8qa_ (1j8q A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
   binds FMN

6. Protein Flavodoxin [52220] (9 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [52222] (25 PDB entries)
   Uniprot P00323

8. Domain d1j8qa_: 1j8q A: [62744]
   complexed with fmn

Details for d1j8qa_

PDB Entry: 1j8q, 1.35 Å

PDB Description: Low Temperature (100K) Crystal Structure of Flavodoxin D. vulgaris Wild-type at 1.35 Angstrom Resolution

PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d1j8qa_:

Sequence; same for both SEQRES and ATOM records:

>d1j8qa_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]}
akalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

Timeline for d1j8qa_:

• d1j8qa_ first appeared in SCOP 1.57
  
• d1j8qa_ appears in SCOPe 2.02
  
• d1j8qa_ appears in SCOPe 2.04
  
• d1j8qa_ appears in the current release, SCOPe 2.08