SCOP 1.69: Domain d1j89e1: 1j89 E:4-85

Lineage for d1j89e1 (1j89 E:4-85)

Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.4: I set domains [49159] (32 proteins)
Protein IgE high affinity receptor alpha subunit [49200] (1 species)
possibly an intermediate structure between the I set and FnIII domains
Species Human (Homo sapiens) [TaxId:9606] [49201] (7 PDB entries)
Domain d1j89e1: 1j89 E:4-85 [62735]

Details for d1j89e1

PDB Entry: 1j89 (more details), 4.1 Å

PDB Description: human high affinity fc receptor fc(epsilon)ri(alpha), tetragonal crystal form 2

SCOP Domain Sequences for d1j89e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j89e1 b.1.1.4 (E:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens)}
kpkvslnppwnrifkgenvtltcngnnffevsstkwfhngslseetnsslnivnakfeds
geykcqhqqvnesepvylevfs

SCOP Domain Coordinates for d1j89e1:

Click to download the PDB-style file with coordinates for d1j89e1.
(The format of our PDB-style files is described here.)

Timeline for d1j89e1: