Lineage for d1j89d2 (1j89 D:86-171)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 290223Family b.1.1.4: I set domains [49159] (29 proteins)
  6. 290332Protein IgE high affinity receptor alpha subunit [49200] (1 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 290333Species Human (Homo sapiens) [TaxId:9606] [49201] (6 PDB entries)
  8. 290361Domain d1j89d2: 1j89 D:86-171 [62734]

Details for d1j89d2

PDB Entry: 1j89 (more details), 4.1 Å

PDB Description: human high affinity fc receptor fc(epsilon)ri(alpha), tetragonal crystal form 2

SCOP Domain Sequences for d1j89d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j89d2 b.1.1.4 (D:86-171) IgE high affinity receptor alpha subunit {Human (Homo sapiens)}
dwlllqasaevvmegqplflrchgwrnwdvykviyykdgealkywyenhnisitnatved
sgtyyctgkvwqldyeseplnitvik

SCOP Domain Coordinates for d1j89d2:

Click to download the PDB-style file with coordinates for d1j89d2.
(The format of our PDB-style files is described here.)

Timeline for d1j89d2: