Lineage for d1j89c2 (1j89 C:86-171)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764414Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1764578Protein IgE high affinity receptor alpha subunit [49200] (1 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 1764579Species Human (Homo sapiens) [TaxId:9606] [49201] (7 PDB entries)
    Uniprot P12319 29-196
  8. 1764613Domain d1j89c2: 1j89 C:86-171 [62732]
    complexed with nag

Details for d1j89c2

PDB Entry: 1j89 (more details), 4.1 Å

PDB Description: human high affinity fc receptor fc(epsilon)ri(alpha), tetragonal crystal form 2
PDB Compounds: (C:) high affinity immunoglobulin epsilon receptor alpha-subunit

SCOPe Domain Sequences for d1j89c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j89c2 b.1.1.4 (C:86-171) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
dwlllqasaevvmegqplflrchgwrnwdvykviyykdgealkywyenhnisitnatved
sgtyyctgkvwqldyeseplnitvik

SCOPe Domain Coordinates for d1j89c2:

Click to download the PDB-style file with coordinates for d1j89c2.
(The format of our PDB-style files is described here.)

Timeline for d1j89c2: