SCOP 1.71: Domain d1j88e2: 1j88 E:86-171

Lineage for d1j88e2 (1j88 E:86-171)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (34 proteins)

6. Protein IgE high affinity receptor alpha subunit [49200] (1 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens) [TaxId:9606] [49201] (7 PDB entries)

8. Domain d1j88e2: 1j88 E:86-171 [62726]
   complexed with man, nag

Details for d1j88e2

PDB Entry: 1j88, 3.2 Å

PDB Description: human high affinity fc receptor fc(epsilon)ri(alpha), tetragonal crystal form 1

SCOP Domain Sequences for d1j88e2:

Sequence; same for both SEQRES and ATOM records:

>d1j88e2 b.1.1.4 (E:86-171) IgE high affinity receptor alpha subunit {Human (Homo sapiens)}
dwlllqasaevvmegqplflrchgwrnwdvykviyykdgealkywyenhnisitnatved
sgtyyctgkvwqldyeseplnitvik

Timeline for d1j88e2:

• d1j88e2 first appeared in SCOP 1.57
  
• d1j88e2 appears in SCOP 1.69
  
• d1j88e2 appears in SCOP 1.73
  
• d1j88e2 appears in the current release, SCOPe 2.08