| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.4: I set domains [49159] (39 proteins) |
| Protein IgE high affinity receptor alpha subunit [49200] (1 species) possibly an intermediate structure between the I set and FnIII domains |
| Species Human (Homo sapiens) [TaxId:9606] [49201] (7 PDB entries) Uniprot P12319 29-196 |
| Domain d1j88c1: 1j88 C:4-85 [62721] complexed with nag |
PDB Entry: 1j88 (more details), 3.2 Å
SCOPe Domain Sequences for d1j88c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j88c1 b.1.1.4 (C:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
kpkvslnppwnrifkgenvtltcngnnffevsstkwfhngslseetnsslnivnakfeds
geykcqhqqvnesepvylevfs
Timeline for d1j88c1: