SCOP 1.67: Domain d1j88b2: 1j88 B:86-171

Lineage for d1j88b2 (1j88 B:86-171)

Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.4: I set domains [49159] (32 proteins)
Protein IgE high affinity receptor alpha subunit [49200] (1 species)
possibly an intermediate structure between the I set and FnIII domains
Species Human (Homo sapiens) [TaxId:9606] [49201] (6 PDB entries)
Domain d1j88b2: 1j88 B:86-171 [62720]

Details for d1j88b2

PDB Entry: 1j88 (more details), 3.2 Å

PDB Description: human high affinity fc receptor fc(epsilon)ri(alpha), tetragonal crystal form 1

SCOP Domain Sequences for d1j88b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j88b2 b.1.1.4 (B:86-171) IgE high affinity receptor alpha subunit {Human (Homo sapiens)}
dwlllqasaevvmegqplflrchgwrnwdvykviyykdgealkywyenhnisitnatved
sgtyyctgkvwqldyeseplnitvik

SCOP Domain Coordinates for d1j88b2:

Click to download the PDB-style file with coordinates for d1j88b2.
(The format of our PDB-style files is described here.)

Timeline for d1j88b2: