SCOP 1.59: Domain d1j88a2: 1j88 A:86-171

Lineage for d1j88a2 (1j88 A:86-171)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.4: I set domains [49159] (25 proteins)

6. Protein IgE high affinity receptor alpha subunit [49200] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49201] (6 PDB entries)

8. Domain d1j88a2: 1j88 A:86-171 [62718]

Details for d1j88a2

PDB Entry: 1j88, 3.2 Å

PDB Description: human high affinity fc receptor fc(epsilon)ri(alpha), tetragonal crystal form 1

SCOP Domain Sequences for d1j88a2:

Sequence; same for both SEQRES and ATOM records:

>d1j88a2 b.1.1.4 (A:86-171) IgE high affinity receptor alpha subunit {Human (Homo sapiens)}
dwlllqasaevvmegqplflrchgwrnwdvykviyykdgealkywyenhnisitnatved
sgtyyctgkvwqldyeseplnitvik

Timeline for d1j88a2:

• d1j88a2 first appeared in SCOP 1.57
  
• d1j88a2 appears in SCOP 1.61
  
• d1j88a2 appears in the current release, SCOPe 2.08