Lineage for d1j88a2 (1j88 A:86-171)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104725Family b.1.1.4: I set domains [49159] (25 proteins)
  6. 104813Protein IgE high affinity receptor alpha subunit [49200] (1 species)
  7. 104814Species Human (Homo sapiens) [TaxId:9606] [49201] (6 PDB entries)
  8. 104822Domain d1j88a2: 1j88 A:86-171 [62718]

Details for d1j88a2

PDB Entry: 1j88 (more details), 3.2 Å

PDB Description: human high affinity fc receptor fc(epsilon)ri(alpha), tetragonal crystal form 1

SCOP Domain Sequences for d1j88a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j88a2 b.1.1.4 (A:86-171) IgE high affinity receptor alpha subunit {Human (Homo sapiens)}
dwlllqasaevvmegqplflrchgwrnwdvykviyykdgealkywyenhnisitnatved
sgtyyctgkvwqldyeseplnitvik

SCOP Domain Coordinates for d1j88a2:

Click to download the PDB-style file with coordinates for d1j88a2.
(The format of our PDB-style files is described here.)

Timeline for d1j88a2: