Lineage for d1j87a2 (1j87 A:86-171)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 454655Family b.1.1.4: I set domains [49159] (32 proteins)
  6. 454776Protein IgE high affinity receptor alpha subunit [49200] (1 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 454777Species Human (Homo sapiens) [TaxId:9606] [49201] (7 PDB entries)
  8. 454805Domain d1j87a2: 1j87 A:86-171 [62716]

Details for d1j87a2

PDB Entry: 1j87 (more details), 3.2 Å

PDB Description: human high affinity fc receptor fc(epsilon)ri(alpha), hexagonal crystal form 1

SCOP Domain Sequences for d1j87a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j87a2 b.1.1.4 (A:86-171) IgE high affinity receptor alpha subunit {Human (Homo sapiens)}
dwlllqasaevvmegqplflrchgwrnwdvykviyykdgealkywyenhnisitnatved
sgtyyctgkvwqldyeseplnitvck

SCOP Domain Coordinates for d1j87a2:

Click to download the PDB-style file with coordinates for d1j87a2.
(The format of our PDB-style files is described here.)

Timeline for d1j87a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j87a1