Lineage for d1j87a1 (1j87 A:1-85)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104725Family b.1.1.4: I set domains [49159] (25 proteins)
  6. 104813Protein IgE high affinity receptor alpha subunit [49200] (1 species)
  7. 104814Species Human (Homo sapiens) [TaxId:9606] [49201] (6 PDB entries)
  8. 104833Domain d1j87a1: 1j87 A:1-85 [62715]

Details for d1j87a1

PDB Entry: 1j87 (more details), 3.2 Å

PDB Description: human high affinity fc receptor fc(epsilon)ri(alpha), hexagonal crystal form 1

SCOP Domain Sequences for d1j87a1:

Sequence, based on SEQRES records: (download)

>d1j87a1 b.1.1.4 (A:1-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens)}
vpqkpkvslnppwnrifkgenvtltcngnnffevsstkwfhngslseetnsslnivnakf
edsgeykcqhqqvnesepvylevfs

Sequence, based on observed residues (ATOM records): (download)

>d1j87a1 b.1.1.4 (A:1-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens)}
vpqkpkvslnppwnrifkgenvtltcngnnffstkwfhngslseetnsslnivnakfeds
geykcqhqqvnesepvylevfs

SCOP Domain Coordinates for d1j87a1:

Click to download the PDB-style file with coordinates for d1j87a1.
(The format of our PDB-style files is described here.)

Timeline for d1j87a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j87a2