SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1j87a1 (1j87 A:1-85)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026186Family b.1.1.4: I set domains [49159] (39 protein domains)
  6. 2026352Protein IgE high affinity receptor alpha subunit [49200] (1 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 2026353Species Human (Homo sapiens) [TaxId:9606] [49201] (7 PDB entries)
    Uniprot P12319 29-196
  8. 2026378Domain d1j87a1: 1j87 A:1-85 [62715]

Details for d1j87a1

PDB Entry: 1j87 (more details), 3.2 Å

PDB Description: human high affinity fc receptor fc(epsilon)ri(alpha), hexagonal crystal form 1
PDB Compounds: (A:) high affinity immunoglobulin epsilon receptor alpha-subunit

SCOPe Domain Sequences for d1j87a1:

Sequence, based on SEQRES records: (download)

>d1j87a1 b.1.1.4 (A:1-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
vpqkpkvslnppwnrifkgenvtltcngnnffevsstkwfhngslseetnsslnivnakf
edsgeykcqhqqvnesepvylevfs

Sequence, based on observed residues (ATOM records): (download)

>d1j87a1 b.1.1.4 (A:1-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
vpqkpkvslnppwnrifkgenvtltcngnnffstkwfhngslseetnsslnivnakfeds
geykcqhqqvnesepvylevfs

SCOPe Domain Coordinates for d1j87a1:

Click to download the PDB-style file with coordinates for d1j87a1.
(The format of our PDB-style files is described here.)

Timeline for d1j87a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j87a2