SCOP 1.73: Domain d1j7vr2: 1j7v R:101-206

Lineage for d1j7vr2 (1j7v R:101-206)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
   Pfam PF00041

6. Protein Interleukin-10 receptor 1, IL-10R1 [63670] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63671] (5 PDB entries)

8. Domain d1j7vr2: 1j7v R:101-206 [62706]
   Other proteins in same PDB: d1j7vl_
   complexed with IL-10
   mutant

Details for d1j7vr2

PDB Entry: 1j7v, 2.9 Å

PDB Description: human il-10 / il-10r1 complex

PDB Compounds: (R:) interleukin-10 receptor alpha chain

SCOP Domain Sequences for d1j7vr2:

Sequence; same for both SEQRES and ATOM records:

>d1j7vr2 b.1.2.1 (R:101-206) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]}
evtltvgsvnleihngfilgkiqlprpkmapaqdtyesifshfreyeiairkvpgqftft
hkkvkheqfslltsgevgefcvqvkpsvasrsnkgmwskeecislt

Timeline for d1j7vr2:

• d1j7vr2 first appeared in SCOP 1.57
  
• d1j7vr2 appears in SCOP 1.71
  
• d1j7vr2 appears in SCOP 1.75
  
• d1j7vr2 appears in the current release, SCOPe 2.08