Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) |
Family b.1.2.1: Fibronectin type III [49266] (20 proteins) |
Protein Interleukin-10 receptor 1, IL-10R1 [63670] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63671] (2 PDB entries) |
Domain d1j7vr2: 1j7v R:101-206 [62706] Other proteins in same PDB: d1j7vl_ complexed with IL-10 mutant |
PDB Entry: 1j7v (more details), 2.9 Å
SCOP Domain Sequences for d1j7vr2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j7vr2 b.1.2.1 (R:101-206) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens)} evtltvgsvnleihngfilgkiqlprpkmapaqdtyesifshfreyeiairkvpgqftft hkkvkheqfslltsgevgefcvqvkpsvasrsnkgmwskeecislt
Timeline for d1j7vr2: