Lineage for d1j7vr2 (1j7v R:101-206)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 54737Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 54738Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 54867Protein Interleukin-10 receptor 1, IL-10R1 [63670] (1 species)
  7. 54868Species Human (Homo sapiens) [TaxId:9606] [63671] (1 PDB entry)
  8. 54870Domain d1j7vr2: 1j7v R:101-206 [62706]
    Other proteins in same PDB: d1j7vl_

Details for d1j7vr2

PDB Entry: 1j7v (more details), 2.9 Å

PDB Description: human il-10 / il-10r1 complex

SCOP Domain Sequences for d1j7vr2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j7vr2 b.1.2.1 (R:101-206) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens)}
evtltvgsvnleihngfilgkiqlprpkmapaqdtyesifshfreyeiairkvpgqftft
hkkvkheqfslltsgevgefcvqvkpsvasrsnkgmwskeecislt

SCOP Domain Coordinates for d1j7vr2:

Click to download the PDB-style file with coordinates for d1j7vr2.
(The format of our PDB-style files is described here.)

Timeline for d1j7vr2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j7vr1
View in 3D
Domains from other chains:
(mouse over for more information)
d1j7vl_