Class a: All alpha proteins [46456] (289 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins) contains an additional helix in one of the crossover connections |
Protein Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) [47306] (3 species) intertwined dimer, similar to interferon-gamma |
Species Human (Homo sapiens) [TaxId:9606] [47307] (6 PDB entries) |
Domain d1j7vl_: 1j7v L: [62704] Other proteins in same PDB: d1j7vr1, d1j7vr2 complexed with IL-10 receptor 1 (IL-10R1) |
PDB Entry: 1j7v (more details), 2.9 Å
SCOPe Domain Sequences for d1j7vl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j7vl_ a.26.1.3 (L:) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Human (Homo sapiens) [TaxId: 9606]} scthfpgnlpnmlrdlrdafsrvktffqmkdqldnlllkeslledfkgylgcqalsemiq fyleevmpqaenqdpdikahvnslgenlktlrlrlrrchrflpcenkskaveqvknafnk lqekgiykamsefdifinyieaymtmkirn
Timeline for d1j7vl_: