SCOP 1.69: Domain d1j7ub_: 1j7u B:

Lineage for d1j7ub_ (1j7u B:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.6: Aminoglycoside phosphotransferases [64411] (2 proteins)

6. Protein Type IIIa 3',5"-aminoglycoside phosphotransferase [64412] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [64413] (5 PDB entries)

8. Domain d1j7ub_: 1j7u B: [62703]

Details for d1j7ub_

PDB Entry: 1j7u, 2.4 Å

PDB Description: Crystal Structure of 3',5"-Aminoglycoside Phosphotransferase Type IIIa AMPPNP Complex

SCOP Domain Sequences for d1j7ub_:

Sequence; same for both SEQRES and ATOM records:

>d1j7ub_ d.144.1.6 (B:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis}
akmrispelkkliekyrcvkdtegmspakvyklvgenenlylkmtdsrykgttydverek
dmmlwlegklpvpkvlhferhdgwsnllmseadgvlcseeyedeqspekiielyaecirl
fhsidisdcpytnsldsrlaeldyllnndladvdcenweedtpfkdprelydflktekpe
eelvfshgdlgdsnifvkdgkvsgfidlgrsgradkwydiafcvrsiredigeeqyvelf
fdllgikpdwekikyyilldelf

Timeline for d1j7ub_:

• d1j7ub_ first appeared in SCOP 1.57
  
• d1j7ub_ appears in SCOP 1.67
  
• d1j7ub_ appears in SCOP 1.71
  
• d1j7ub_ appears in the current release, SCOPe 2.08