Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.6: APH phosphotransferases [64411] (5 proteins) |
Protein Type IIIa 3',5'-aminoglycoside phosphotransferase [64412] (1 species) |
Species Enterococcus faecalis [TaxId:1351] [64413] (10 PDB entries) |
Domain d1j7lb_: 1j7l B: [62698] complexed with adp, mg |
PDB Entry: 1j7l (more details), 2.2 Å
SCOPe Domain Sequences for d1j7lb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j7lb_ d.144.1.6 (B:) Type IIIa 3',5'-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} akmrispelkkliekyrcvkdtegmspakvyklvgenenlylkmtdsrykgttydverek dmmlwlegklpvpkvlhferhdgwsnllmseadgvlcseeyedeqspekiielyaecirl fhsidisdcpytnsldsrlaeldyllnndladvdcenweedtpfkdprelydflktekpe eelvfshgdlgdsnifvkdgkvsgfidlgrsgradkwydiafcvrsiredigeeqyvelf fdllgikpdwekikyyilldelf
Timeline for d1j7lb_: