SCOPe 2.08: Domain d1j7la_: 1j7l A:

Lineage for d1j7la_ (1j7l A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.6: APH phosphotransferases [64411] (5 proteins)

6. Protein Type IIIa 3',5'-aminoglycoside phosphotransferase [64412] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [64413] (10 PDB entries)

8. Domain d1j7la_: 1j7l A: [62697]
   complexed with adp, mg

Details for d1j7la_

PDB Entry: 1j7l, 2.2 Å

PDB Description: Crystal Structure of 3',5"-Aminoglycoside Phosphotransferase Type IIIa ADP Complex

PDB Compounds: (A:) Aminoglycoside 3'-phosphotransferase

SCOPe Domain Sequences for d1j7la_:

Sequence; same for both SEQRES and ATOM records:

>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5'-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]}
akmrispelkkliekyrcvkdtegmspakvyklvgenenlylkmtdsrykgttydverek
dmmlwlegklpvpkvlhferhdgwsnllmseadgvlcseeyedeqspekiielyaecirl
fhsidisdcpytnsldsrlaeldyllnndladvdcenweedtpfkdprelydflktekpe
eelvfshgdlgdsnifvkdgkvsgfidlgrsgradkwydiafcvrsiredigeeqyvelf
fdllgikpdwekikyyilldelf

Timeline for d1j7la_:

• d1j7la_ first appeared in SCOP 1.57
  
• d1j7la_ appears in SCOPe 2.07