Lineage for d1j7ka2 (1j7k A:19-254)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 70260Family c.37.1.13: Extended AAA-ATPase domain [52700] (15 proteins)
  6. 70307Protein Holliday junction helicase RuvB [52713] (2 species)
  7. 70308Species Thermotoga maritima [TaxId:243274] [64037] (6 PDB entries)
  8. 70310Domain d1j7ka2: 1j7k A:19-254 [62696]
    Other proteins in same PDB: d1j7ka1

Details for d1j7ka2

PDB Entry: 1j7k (more details), 1.8 Å

PDB Description: thermotoga maritima ruvb p216g mutant

SCOP Domain Sequences for d1j7ka2:

Sequence, based on SEQRES records: (download)

>d1j7ka2 c.37.1.13 (A:19-254) Holliday junction helicase RuvB {Thermotoga maritima}
lrpksldefigqenvkkklslaleaakmrgevldhvllagppglgkttlahiiaselqtn
ihvtsgpvlvkqgdmaailtslergdvlfideihrlnkaveellysaiedfqidimigkg
psaksiridiqpftlvgattrsgllssplrsrfgiileldfytvkelkeiikraaslmdv
eiedaaaemiakrsrgtgriairltkrvrdmltvvkadrintdivlktmevlnidd

Sequence, based on observed residues (ATOM records): (download)

>d1j7ka2 c.37.1.13 (A:19-254) Holliday junction helicase RuvB {Thermotoga maritima}
lrpksldefigqenvkkklslaleaakmrgevldhvllagppglgkttlahiiaselqtn
ihvtsgpvlvkqgdmaailtslergdvlfideihrlnkaveellysaiedfqidiidiqp
ftlvgattrsgllssplrsrfgiileldfytvkelkeiikraaslmdveiedaaaemiak
rsrgtgriairltkrvrdmltvvkadrintdivlktmevlnidd

SCOP Domain Coordinates for d1j7ka2:

Click to download the PDB-style file with coordinates for d1j7ka2.
(The format of our PDB-style files is described here.)

Timeline for d1j7ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j7ka1