Lineage for d1j7ka1 (1j7k A:255-329)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45282Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 45500Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (31 families) (S)
  5. 45587Family a.4.5.11: Helicase DNA-binding domain [46819] (2 proteins)
  6. 45592Protein Holliday junction helicase RuvB [46820] (2 species)
  7. 45593Species Thermotoga maritima [TaxId:243274] [63474] (6 PDB entries)
  8. 45595Domain d1j7ka1: 1j7k A:255-329 [62695]
    Other proteins in same PDB: d1j7ka2

Details for d1j7ka1

PDB Entry: 1j7k (more details), 1.8 Å

PDB Description: thermotoga maritima ruvb p216g mutant
PDB Compounds: (A:)

SCOP Domain Sequences for d1j7ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j7ka1 a.4.5.11 (A:255-329) Holliday junction helicase RuvB {Thermotoga maritima}
egldefdrkilktiieiyrggpvglnalaaslgveadtlsevyepyllqagflartprgr
ivtekaykhlkyevp

SCOP Domain Coordinates for d1j7ka1:

Click to download the PDB-style file with coordinates for d1j7ka1.
(The format of our PDB-style files is described here.)

Timeline for d1j7ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j7ka2