Lineage for d1j7db_ (1j7d B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546033Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2546034Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2546035Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2546043Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2546139Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (19 PDB entries)
  8. 2546142Domain d1j7db_: 1j7d B: [62681]
    complexed with Mms2

Details for d1j7db_

PDB Entry: 1j7d (more details), 1.85 Å

PDB Description: Crystal Structure of hMms2-hUbc13
PDB Compounds: (B:) ubiquitin-conjugating enzyme e2-17 kda

SCOPe Domain Sequences for d1j7db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee
ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpl
andvaeqwktneaqaietarawtrlyamn

SCOPe Domain Coordinates for d1j7db_:

Click to download the PDB-style file with coordinates for d1j7db_.
(The format of our PDB-style files is described here.)

Timeline for d1j7db_: