SCOP 1.57: Domain d1j7db_: 1j7d B:

Lineage for d1j7db_ (1j7d B:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.20: Ubiquitin conjugating enzyme [54494] (1 superfamily)

4. Superfamily d.20.1: Ubiquitin conjugating enzyme [54495] (1 family)

5. Family d.20.1.1: Ubiquitin conjugating enzyme [54496] (1 protein)

6. Protein Ubiquitin conjugating enzyme [54497] (12 species)

7. Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (1 PDB entry)

8. Domain d1j7db_: 1j7d B: [62681]

Details for d1j7db_

PDB Entry: 1j7d, 1.85 Å

PDB Description: Crystal Structure of hMms2-hUbc13

SCOP Domain Sequences for d1j7db_:

Sequence; same for both SEQRES and ATOM records:

>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme {Human (Homo sapiens), ubc13}
aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee
ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpl
andvaeqwktneaqaietarawtrlyamn

Timeline for d1j7db_:

• d1j7db_ is new in SCOP 1.57
  
• d1j7db_ appears in SCOP 1.59
  
• d1j7db_ appears in the current release, SCOPe 2.08