| Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
| Fold d.20: Ubiquitin conjugating enzyme [54494] (1 superfamily) |
Superfamily d.20.1: Ubiquitin conjugating enzyme [54495] (1 family) ![]() |
| Family d.20.1.1: Ubiquitin conjugating enzyme [54496] (1 protein) |
| Protein Ubiquitin conjugating enzyme [54497] (12 species) |
| Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (1 PDB entry) |
| Domain d1j7db_: 1j7d B: [62681] |
PDB Entry: 1j7d (more details), 1.85 Å
SCOP Domain Sequences for d1j7db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme {Human (Homo sapiens), ubc13}
aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee
ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpl
andvaeqwktneaqaietarawtrlyamn
Timeline for d1j7db_: