Lineage for d1j7da_ (1j7d A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1642804Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1642805Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1642806Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1642814Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1642878Species Human (Homo sapiens), mms2 [TaxId:9606] [64242] (6 PDB entries)
  8. 1642879Domain d1j7da_: 1j7d A: [62680]
    complexed with ubc13

Details for d1j7da_

PDB Entry: 1j7d (more details), 1.85 Å

PDB Description: Crystal Structure of hMms2-hUbc13
PDB Compounds: (A:) mms2

SCOPe Domain Sequences for d1j7da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j7da_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), mms2 [TaxId: 9606]}
gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl
kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl
mmskenmklpqppegqtynn

SCOPe Domain Coordinates for d1j7da_:

Click to download the PDB-style file with coordinates for d1j7da_.
(The format of our PDB-style files is described here.)

Timeline for d1j7da_: