Lineage for d1j7da_ (1j7d A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78902Fold d.20: Ubiquitin conjugating enzyme [54494] (1 superfamily)
  4. 78903Superfamily d.20.1: Ubiquitin conjugating enzyme [54495] (1 family) (S)
  5. 78904Family d.20.1.1: Ubiquitin conjugating enzyme [54496] (1 protein)
  6. 78905Protein Ubiquitin conjugating enzyme [54497] (12 species)
  7. 78924Species Human (Homo sapiens), mms2 [TaxId:9606] [64242] (2 PDB entries)
  8. 78925Domain d1j7da_: 1j7d A: [62680]

Details for d1j7da_

PDB Entry: 1j7d (more details), 1.85 Å

PDB Description: Crystal Structure of hMms2-hUbc13

SCOP Domain Sequences for d1j7da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j7da_ d.20.1.1 (A:) Ubiquitin conjugating enzyme {Human (Homo sapiens), mms2}
gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl
kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl
mmskenmklpqppegqtynn

SCOP Domain Coordinates for d1j7da_:

Click to download the PDB-style file with coordinates for d1j7da_.
(The format of our PDB-style files is described here.)

Timeline for d1j7da_: