![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
![]() | Protein 2Fe-2S ferredoxin [54294] (19 species) |
![]() | Species Anabaena sp., pcc 7119 and 7120 [TaxId:1167] [54295] (12 PDB entries) |
![]() | Domain d1j7ca_: 1j7c A: [62679] complexed with fes; mutant |
PDB Entry: 1j7c (more details), 1.8 Å
SCOPe Domain Sequences for d1j7ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j7ca_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Anabaena sp., pcc 7119 and 7120 [TaxId: 1167]} atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq sdqsfldddqieagyvltcvayptsdvviqthkekdly
Timeline for d1j7ca_: