Lineage for d1j7ba_ (1j7b A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1403183Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1403184Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 1403185Protein 2Fe-2S ferredoxin [54294] (17 species)
  7. 1403186Species Anabaena sp., pcc 7119 and 7120 [TaxId:1167] [54295] (12 PDB entries)
  8. 1403201Domain d1j7ba_: 1j7b A: [62678]
    complexed with fes; mutant

Details for d1j7ba_

PDB Entry: 1j7b (more details), 1.8 Å

PDB Description: structure of the anabaena ferredoxin mutant e94k
PDB Compounds: (A:) ferredoxin I

SCOPe Domain Sequences for d1j7ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j7ba_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Anabaena sp., pcc 7119 and 7120 [TaxId: 1167]}
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
sdqsfldddqieagyvltcvayptsdvviqthkkedly

SCOPe Domain Coordinates for d1j7ba_:

Click to download the PDB-style file with coordinates for d1j7ba_.
(The format of our PDB-style files is described here.)

Timeline for d1j7ba_: