Lineage for d1j79a_ (1j79 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 572244Superfamily c.1.9: Metallo-dependent hydrolases [51556] (13 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 572348Family c.1.9.4: Dihydroorotase [63917] (1 protein)
  6. 572349Protein Dihydroorotase [63918] (1 species)
  7. 572350Species Escherichia coli [TaxId:562] [63919] (1 PDB entry)
  8. 572351Domain d1j79a_: 1j79 A: [62675]

Details for d1j79a_

PDB Entry: 1j79 (more details), 1.7 Å

PDB Description: Molecular Structure of Dihydroorotase: A Paradigm for Catalysis Through the Use of a Binuclear Metal Center

SCOP Domain Sequences for d1j79a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j79a_ c.1.9.4 (A:) Dihydroorotase {Escherichia coli}
sqvlkirrpddwhlhlrdgdmlktvvpytseiygraivmpnlappvttveaavayrqril
davpaphdftplmtcyltdsldpnelergfnegvftaaklypanattnsshgvtsvdaim
pvlermekigmpllvhgevthadidifdrearfiesvmeplrqrltalkvvfehittkda
adyvrdgnerlaatitpqhlmfnrnhmlvggvrphlyclpilkrnihqqalrelvasgfq
rvflgtdsapharhrkesscgcagcfnaptalgsyatvfeemnalqhfeafcsvngpqfy
glpvndtfielvreeqqvaesialtddtlvpflagetvrwsvk

SCOP Domain Coordinates for d1j79a_:

Click to download the PDB-style file with coordinates for d1j79a_.
(The format of our PDB-style files is described here.)

Timeline for d1j79a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1j79b_