Lineage for d1j77a_ (1j77 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777762Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 777763Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 777868Family a.132.1.2: Heme oxygenase HemO (PigA) [63627] (1 protein)
  6. 777869Protein Heme oxygenase HemO (PigA) [63628] (2 species)
    gram-negative bacterial heme oxygenase/iron-starvation protein
  7. 777870Species Neisseria meningitidis [TaxId:487] [63629] (4 PDB entries)
  8. 777871Domain d1j77a_: 1j77 A: [62674]
    complexed with hem

Details for d1j77a_

PDB Entry: 1j77 (more details), 1.5 Å

PDB Description: Crystal Structure of Gram-negative Bacterial Heme Oxygenase Complexed with Heme
PDB Compounds: (A:) HemO

SCOP Domain Sequences for d1j77a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j77a_ a.132.1.2 (A:) Heme oxygenase HemO (PigA) {Neisseria meningitidis [TaxId: 487]}
altfakrlkadttavhdsvdnlvmsvqpfvskenyikflklqsvfhkavdhiykdaelnk
aipeleymarydavtqdlkdlgeepykfdkelpyeagnkaigwlycaegsnlgaaflfkh
aqkldyngehgarhlaphpdgrgkhwrafvehlnalnltpeaeaeaiqgareafafykvv
lretfglaadaeapegmmph

SCOP Domain Coordinates for d1j77a_:

Click to download the PDB-style file with coordinates for d1j77a_.
(The format of our PDB-style files is described here.)

Timeline for d1j77a_: