Lineage for d1j75a_ (1j75 A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45282Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 45500Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (31 families) (S)
  5. 45656Family a.4.5.19: Z-DNA binding domain [46853] (2 proteins)
  6. 45657Protein Dlm-1 [63486] (1 species)
  7. 45658Species Mouse (Mus musculus) [TaxId:10090] [63487] (1 PDB entry)
  8. 45659Domain d1j75a_: 1j75 A: [62673]

Details for d1j75a_

PDB Entry: 1j75 (more details), 1.85 Å

PDB Description: Crystal Structure of the DNA-Binding Domain Zalpha of DLM-1 Bound to Z-DNA

SCOP Domain Sequences for d1j75a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j75a_ a.4.5.19 (A:) Dlm-1 {Mouse (Mus musculus)}
nleqkilqvlsddggpvkigqlvkkcqvpkktlnqvlyrlkkedrvsspepatwsig

SCOP Domain Coordinates for d1j75a_:

Click to download the PDB-style file with coordinates for d1j75a_.
(The format of our PDB-style files is described here.)

Timeline for d1j75a_: