Lineage for d1j74a_ (1j74 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1406945Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1406946Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1406947Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1406955Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1407018Species Human (Homo sapiens), mms2 [TaxId:9606] [64242] (3 PDB entries)
  8. 1407020Domain d1j74a_: 1j74 A: [62672]

Details for d1j74a_

PDB Entry: 1j74 (more details), 1.9 Å

PDB Description: Crystal Structure of Mms2
PDB Compounds: (A:) mms2

SCOPe Domain Sequences for d1j74a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j74a_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), mms2 [TaxId: 9606]}
vkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriyslk
vecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrlm
mskenmklpqppegqtynn

SCOPe Domain Coordinates for d1j74a_:

Click to download the PDB-style file with coordinates for d1j74a_.
(The format of our PDB-style files is described here.)

Timeline for d1j74a_: