SCOP 1.69: Domain d1j71a_: 1j71 A:

Lineage for d1j71a_ (1j71 A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.2: Pepsin-like [50646] (10 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Acid protease [50649] (9 species)

7. Species Yeast (Candida tropicalis) [TaxId:5482] [63795] (1 PDB entry)

8. Domain d1j71a_: 1j71 A: [62669]

Details for d1j71a_

PDB Entry: 1j71, 1.8 Å

PDB Description: structure of the extracellular aspartic proteinase from candida tropicalis yeast.

SCOP Domain Sequences for d1j71a_:

Sequence; same for both SEQRES and ATOM records:

>d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis)}
sdvpttlinegpsyaadivvgsnqqkqtvvidtgssdlwvvdtdaecqvtysgqtnnfck
qegtfdpsssssaqnlnqdfsieygdltssqgsfykdtvgfggisiknqqfadvtttsvd
qgimgigftadeagynlydnvpvtlkkqgiinknayslylnsedastgkiifggvdnaky
tgtltalpvtssvelrvhlgsinfdgtsvstnadvvldsgttityfsqstadkfarivga
twdsrneiyrlpscdlsgdavfnfdqgvkitvplselilkdsdssicyfgisrndanilg
dnflrrayivydlddktislaqvkytsssdisal

Timeline for d1j71a_:

• d1j71a_ first appeared in SCOP 1.57
  
• d1j71a_ appears in SCOP 1.67
  
• d1j71a_ appears in SCOP 1.71
  
• d1j71a_ appears in the current release, SCOPe 2.08