Lineage for d1j71a_ (1j71 A:)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily) Superfamily b.50.1: Acid proteases [50630] (2 families) 
Family b.50.1.2: Pepsin-like [50646] (9 proteins) Protein Acid protease [50649] (7 species) 
Species Yeast (Candida tropicalis) [TaxId:5482] [63795] (1 PDB entry) 
Domain d1j71a_: 1j71 A: [62669]
Details for d1j71a_
PDB Entry: 1j71 (more details), 1.8 Å
PDB Description: structure of the extracellular aspartic proteinase from candida tropicalis yeast.
SCOP Domain Sequences for d1j71a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis)}
sdvpttlinegpsyaadivvgsnqqkqtvvidtgssdlwvvdtdaecqvtysgqtnnfck
qegtfdpsssssaqnlnqdfsieygdltssqgsfykdtvgfggisiknqqfadvtttsvd
qgimgigftadeagynlydnvpvtlkkqgiinknayslylnsedastgkiifggvdnaky
tgtltalpvtssvelrvhlgsinfdgtsvstnadvvldsgttityfsqstadkfarivga
twdsrneiyrlpscdlsgdavfnfdqgvkitvplselilkdsdssicyfgisrndanilg
dnflrrayivydlddktislaqvkytsssdisal
SCOP Domain Coordinates for d1j71a_:
Click to download the PDB-style file with coordinates for d1j71a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j71a_:
- d1j71a_ is new in SCOP 1.57
- d1j71a_ appears in SCOP 1.59
- d1j71a_ appears in the current release, SCOPe 2.08
View in 3D