SCOP 1.57: Domain d1j6xb_: 1j6x B:

Lineage for d1j6xb_ (1j6x B:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)

5. Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (1 protein)

6. Protein Autoinducer-2 production protein LuxS [64295] (4 species)

7. Species Helicobacter pylori [TaxId:210] [64299] (1 PDB entry)

8. Domain d1j6xb_: 1j6x B: [62666]

Details for d1j6xb_

PDB Entry: 1j6x, 2.38 Å

PDB Description: crystal structure of helicobacter pylori luxs

SCOP Domain Sequences for d1j6xb_:

Sequence; same for both SEQRES and ATOM records:

>d1j6xb_ d.185.1.2 (B:) Autoinducer-2 production protein LuxS {Helicobacter pylori}
mkmnvesfnldhtkvkapyvriadrkkgvngdlivkydvrfkqpnrdhmdmpslhslehl
vaeiirnhanyvvdwspmgcqtgfyltvlnhdnyteilevlektmqdvlkakevpasnek
qcgwaanhtlegaqnlarafldkraewsevgv

Timeline for d1j6xb_:

• d1j6xb_ is new in SCOP 1.57
  
• d1j6xb_ appears in SCOP 1.59
  
• d1j6xb_ appears in the current release, SCOPe 2.08, called d1j6xb1