SCOPe 2.06: Domain d1j6wb_: 1j6w B:

Lineage for d1j6wb_ (1j6w B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (2 proteins)
   contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1)
   automatically mapped to Pfam PF02664

6. Protein Autoinducer-2 production protein LuxS [64295] (5 species)
   S-ribosylhomocysteinase

7. Species Haemophilus influenzae [TaxId:727] [64298] (2 PDB entries)

8. Domain d1j6wb_: 1j6w B: [62664]
   complexed with met, zn

Details for d1j6wb_

PDB Entry: 1j6w, 2.1 Å

PDB Description: crystal structure of haemophilus influenzae luxs

PDB Compounds: (B:) autoinducer-2 production protein luxs

SCOPe Domain Sequences for d1j6wb_:

Sequence; same for both SEQRES and ATOM records:

>d1j6wb_ d.185.1.2 (B:) Autoinducer-2 production protein LuxS {Haemophilus influenzae [TaxId: 727]}
lldsfkvdhtkmnapavriaktmltpkgdnitvfdlrfcipnkeilspkgihtlehlfag
fmrdhlngdsieiidispmgcrtgfymsligtpneqkvseawlasmqdvlgvqdqasipe
lniyqcgsytehsledaheiaknviargigvnknedlsld

Timeline for d1j6wb_:

• d1j6wb_ first appeared in SCOP 1.57
  
• d1j6wb_ appears in SCOPe 2.05
  
• d1j6wb_ appears in SCOPe 2.07
  
• d1j6wb_ appears in the current release, SCOPe 2.08